PDB entry 1yu8

View 1yu8 on RCSB PDB site
Description: Crystal Structure of the R37A Mutant of Villin Headpiece
Class: structural protein
Keywords: alpha helix, 3-10 helix, STRUCTURAL PROTEIN
Deposited on 2005-02-12, released 2005-09-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.192
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: villin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02640 (Start-66)
      • engineered (27)
    Domains in SCOPe 2.07: d1yu8x_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1yu8X (X:)
    ptkletfpldvlvntaaedlprgvdpsakenhlsdedfkavfgmtrsafanlplwkqqnl
    kkekglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yu8X (X:)
    letfpldvlvntaaedlprgvdpsakenhlsdedfkavfgmtrsafanlplwkqqnlkke
    kglf