PDB entry 1yu3

View 1yu3 on RCSB PDB site
Description: Major Tropism Determinant I1 Variant
Class: Viral protein
Keywords: C-type Lectin, Beta Sandwich, Beta Prism, variability, diversity-generating retroelement
Deposited on 2005-02-11, released 2005-09-20
The last revision prior to the SCOP 1.73 freeze date was dated 2005-10-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: 0.173
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major Tropism Determinant (Mtd-I1)
    Species: Bordetella phage BIP-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q775D6
      • see remark 999 (201)
      • see remark 999 (217)
    Domains in SCOP 1.73: d1yu3a1, d1yu3a2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yu3A (A:)
    mstavqfrggttaqhatftgaareitvdtdkntvvvhdgataggfplarhdlvktafika
    dksavaftrtgnatasikagtivevngklvqftadtaitmpaltagtdyaiyvcddgtvr
    adsnfsaptgytsttarkvggfhyapgsnaaaqaggnttaqineyslwdikfrpaaldpr
    gmtlvagafwadiyllgvnhltdgtskynvtiadgsaspkkstkfggdgsaaysdgawyn
    faevmthhgkrlpnynefqalafgtteatssggtdvpttgvngtgatsawniftskwgvv
    qasgclwtwgnefggvngaseytantggrgsvyaqpaaalfggswfytsysgsraaywna
    gpsnssanigargvcdhlile
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yu3A (A:)
    vqfrggttaqhatftgaareitvdtdkntvvvhdgataggfplarhdlvktafikadksa
    vaftrtgnatasikagtivevngklvqftadtaitmpaltagtdyaiyvcddgtvradsn
    fsaptgytsttarkvggfhyapgsnaaaqaggnttaqineyslwdikfrpaaldprgmtl
    vagafwadiyllgvnhltdgtskynvtiadgsaspkkstkfggdgsaaysdgawynfaev
    mthhgkrlpnynefqalafgtteatssggtdvpttgvngtgatsawniftskwgvvqasg
    clwtwgnefggvngaseytantggrgsvyaqpaaalfggswfytsysgsraaywnagpsn
    ssanigargvcdhlil