PDB entry 1yu0

View 1yu0 on RCSB PDB site
Description: Major Tropism Determinant P1 Variant
Class: Viral protein
Keywords: C-type Lectin, Beta Sandwich, Beta Prism, variability, diversity-generating retroelement, Viral protein
Deposited on 2005-02-11, released 2005-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: 0.128
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major Tropism Determinant (Mtd-P1)
    Species: Bordetella phage BPP-1 [TaxId:194699]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yu0a1, d1yu0a2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yu0A (A:)
    mstavqfrggttaqhatftgaareitvdtdkntvvvhdgataggfplarhdlvktafika
    dksavaftrtgnatasikagtivevngklvqftadtaitmpaltagtdyaiyvcddgtvr
    adsnfsaptgytsttarkvggfhyapgsnaaaqaggnttaqineyslwdikfrpaaldpr
    gmtlvagafwadiyllgvnhltdgtskynvtiadgsaspkkstkfggdgsaaysdgawyn
    faevmthhgkrlpnynefqalafgtteatssggtdvpttgvngtgatsawniftskwgvv
    qasgclwtwgnefggvngaseytantggrgsvyaqpaaalfggawngtslsgsraalwys
    gpsfsfaffgargvcdhlile
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yu0A (A:)
    vqfrggttaqhatftgaareitvdtdkntvvvhdgataggfplarhdlvktafikadksa
    vaftrtgnatasikagtivevngklvqftadtaitmpaltagtdyaiyvcddgtvradsn
    fsaptgytsttarkvggfhyapgsnaaaqaggnttaqineyslwdikfrpaaldprgmtl
    vagafwadiyllgvnhltdgtskynvtiadgsaspkkstkfggdgsaaysdgawynfaev
    mthhgkrlpnynefqalafgtteatssggtdvpttgvngtgatsawniftskwgvvqasg
    clwtwgnefggvngaseytantggrgsvyaqpaaalfggawngtslsgsraalwysgpsf
    sfaffgargvcdhlil