PDB entry 1yty

View 1yty on RCSB PDB site
Description: Structural basis for recognition of UUUOH 3'-terminii of nascent RNA pol III transcripts by La autoantigen
Class: transcription/RNA
Keywords: Protein-RNA complex
Deposited on 2005-02-11, released 2006-01-17
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: 0.222
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lupus La protein
    Species: HOMO SAPIENS
    Gene: ssb
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05455
      • modified residue (9)
      • modified residue (51)
      • modified residue (79)
      • modified residue (141)
    Domains in SCOP 1.73: d1ytya1, d1ytya2
  • Chain 'B':
    Compound: Lupus La protein
    Species: HOMO SAPIENS
    Gene: ssb
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05455
      • modified residue (9)
      • modified residue (51)
      • modified residue (79)
      • modified residue (141)
    Domains in SCOP 1.73: d1ytyb1, d1ytyb2
  • Chain 'C':
    Compound: 5'-r(*up*gp*cp*up*gp*up*up*up*u)-3'
  • Chain 'D':
    Compound: 5'-r(*up*gp*cp*up*gp*up*up*up*u)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ytyA (A:)
    maengdnekmaaleakichqieyyfgdfnlprdkflkeqikldegwvpleimikfnrlnr
    lttdfnvivealskskaelmeisedktkirrspskplpevtdeykndvknrsvyikgfpt
    datlddikewledkgqvlniqmrrtlhkafkgsifvvfdsiesakkfvetpgqkyketdl
    lilfkddyfakkne
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ytyA (A:)
    dnekmaaleakichqieyyfgdfnlprdkflkeqikldegwvpleimikfnrlnrlttdf
    nvivealskskaelmeisedktkirrspskplpevtdeykndvknrsvyikgfptdatld
    dikewledkgqvlniqmrrtlhkafkgsifvvfdsiesakkfvetpgqkyketdllilfk
    ddyf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ytyB (B:)
    maengdnekmaaleakichqieyyfgdfnlprdkflkeqikldegwvpleimikfnrlnr
    lttdfnvivealskskaelmeisedktkirrspskplpevtdeykndvknrsvyikgfpt
    datlddikewledkgqvlniqmrrtlhkafkgsifvvfdsiesakkfvetpgqkyketdl
    lilfkddyfakkne
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ytyB (B:)
    nekmaaleakichqieyyfgdfnlprdkflkeqikldegwvpleimikfnrlnrlttdfn
    vivealskskaelmeisedktkirrspskplpevtdeykndvknrsvyikgfptdatldd
    ikewledkgqvlniqmrrtlhkafkgsifvvfdsiesakkfvetpgqkyketdllilfkd
    dyf
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.