PDB entry 1ytw

View 1ytw on RCSB PDB site
Description: yersinia ptpase complexed with tungstate
Deposited on 1996-05-01, released 1996-11-08
The last revision prior to the SCOP 1.55 freeze date was dated 1996-11-08, with a file datestamp of 1996-11-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.179
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1ytw__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ytw_ (-)
    vspygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradln
    anyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqs
    gtygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevt
    kalaslvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrns
    qlsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns