PDB entry 1ytv

View 1ytv on RCSB PDB site
Description: Maltose-binding protein fusion to a C-terminal fragment of the V1a vasopressin receptor
Class: sugar binding protein, hormone receptor
Keywords: vasopressin; receptor; GPCR; fusion protein; maltose-binding protein, SUGAR BINDING PROTEIN, HORMONE RECEPTOR
Deposited on 2005-02-11, released 2005-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.199
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Maltose-binding periplasmic protein
    Species: Escherichia coli [TaxId:562]
    Gene: malE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ytva_
  • Chain 'B':
    Compound: Maltose-binding periplasmic protein
    Species: Escherichia coli [TaxId:562]
    Gene: malE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ytvb_
  • Chain 'M':
    Compound: Vasopressin V1a receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: AVPR1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37288
      • linker sequence (0-5)
  • Chain 'N':
    Compound: Vasopressin V1a receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: AVPR1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37288
      • linker sequence (0-4)
  • Heterogens: MAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ytvA (A:)
    kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
    fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
    llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
    vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
    nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
    avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
    lkdaqt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ytvB (B:)
    kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
    fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
    llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
    vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
    nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
    avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
    lkdaqt
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.