PDB entry 1ytu

View 1ytu on RCSB PDB site
Description: Structural basis for 5'-end-specific recognition of the guide RNA strand by the A. fulgidus PIWI protein
Class: RNA binding Protein/RNA
Keywords: Protein-RNA complex, RNA duplex, RNA binding Protein-RNA COMPLEX
Deposited on 2005-02-11, released 2005-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.207
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein af1318
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28951 (Start-426)
      • modified residue (1)
      • modified residue (111)
      • modified residue (138)
      • modified residue (199)
      • modified residue (207)
      • modified residue (259)
      • modified residue (279)
      • modified residue (300)
      • modified residue (376)
    Domains in SCOPe 2.07: d1ytua2, d1ytua3
  • Chain 'B':
    Compound: hypothetical protein af1318
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28951 (0-426)
      • modified residue (0-1)
      • modified residue (111)
      • modified residue (138)
      • modified residue (199)
      • modified residue (207)
      • modified residue (259)
      • modified residue (279)
      • modified residue (300)
      • modified residue (338)
      • modified residue (376)
    Domains in SCOPe 2.07: d1ytub2, d1ytub3
  • Chain 'C':
    Compound: 5'-r(p*ap*gp*ap*cp*ap*g)-3'
  • Chain 'D':
    Compound: 5'-r(p*up*gp*up*c)-3'
  • Chain 'E':
    Compound: 5'-r(p*ap*gp*ap*cp*ap*g)-3'
  • Chain 'F':
    Compound: 5'-r(p*up*gp*up*c)-3'
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ytuA (A:)
    mmeykivengltyrigngasvpisntgelikglrnygpyevpslkynqialihnnqfssl
    inqlksqisskidevwhihninisefiydsphfdsiksqvdnaidtgvdgimlvlpeynt
    plyyklksylinsipsqfmrydilsnrnltfyvdnllvqfvsklggkpwilnvdpekgsd
    iiigtgatridnvnlfcfamvfkkdgtmlwneispivtsseyltylkstikkvvygfkks
    npdwdvekltlhvsgkrpkmkdgetkilketveelkkqemvsrdvkyailhlnethpfwv
    mgdpnnrfhpyegtkvklsskrylltllqpylkrnglemvtpikplsveivsdnwtseey
    yhnvheildeiyylskmnwrgfrsrnlpvtvnypklvagiianvnryggypinpegnrsl
    qtnpwfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ytuA (A:)
    meykivengltyrigngasvpisntgelikglrnygpyevpslkynqialihnnqfssli
    nqlksqisskidevwhihninisefiydsphfdsiksqvdnaidtgvdgimlvlpeyntp
    lyyklksylinsipsqfmrydilsnrnltfyvdnllvqfvsklggkpwilnvdpekgsdi
    iigtgatridnvnlfcfamvfkkdgtmlwneispivtsseyltylkstikkvvygfkksn
    pdwdvekltlhvsgkrpkmkdgetkilketveelkkqemvsrdvkyailhlnethpfwvm
    gdpyegtkvklsskrylltllqpypikplsveivsdnwtseeyyhnvheildeiyylskm
    nwrgfrsrnlpvtvnypklvagiianvnryggypinpegnrslqtnpwfl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ytuB (B:)
    mmeykivengltyrigngasvpisntgelikglrnygpyevpslkynqialihnnqfssl
    inqlksqisskidevwhihninisefiydsphfdsiksqvdnaidtgvdgimlvlpeynt
    plyyklksylinsipsqfmrydilsnrnltfyvdnllvqfvsklggkpwilnvdpekgsd
    iiigtgatridnvnlfcfamvfkkdgtmlwneispivtsseyltylkstikkvvygfkks
    npdwdvekltlhvsgkrpkmkdgetkilketveelkkqemvsrdvkyailhlnethpfwv
    mgdpnnrfhpyegtkvklsskrylltllqpylkrnglemvtpikplsveivsdnwtseey
    yhnvheildeiyylskmnwrgfrsrnlpvtvnypklvagiianvnryggypinpegnrsl
    qtnpwfl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.