PDB entry 1ytt

View 1ytt on RCSB PDB site
Description: yb substituted subtilisin fragment of mannose binding protein-a (sub-mbp-a), mad structure at 110k
Class: mannose-binding protein
Keywords: carbohydrate, recognition domain, calcium dependent, mannose-binding protein
Deposited on 1995-11-09, released 1996-06-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.185
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mannose-binding protein a
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ytta_
  • Chain 'B':
    Compound: mannose-binding protein a
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yttb_
  • Heterogens: YB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yttA (A:)
    sgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevteg
    qfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqashtavcefpa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yttB (B:)
    sgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevteg
    qfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqashtavcefpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yttB (B:)
    gkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevtegq
    fmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqashtavcef