PDB entry 1yts

View 1yts on RCSB PDB site
Description: a ligand-induced conformational change in the yersinia protein tyrosine phosphatase
Deposited on 1995-04-07, released 1995-07-10
The last revision prior to the SCOP 1.69 freeze date was dated 1995-07-10, with a file datestamp of 1995-07-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.174
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1yts__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yts_ (-)
    pearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlnanyiq
    vgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsgtygs
    itveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevtkalas
    lvdqtaetkrnmyeskgssavaddsklrpvihsragvgrtaqligamcmndsrnsqlsve
    dmvsqmrvqrngimvqkdeqldvliklaegqgrpllns