PDB entry 1yts

View 1yts on RCSB PDB site
Description: a ligand-induced conformational change in the yersinia protein tyrosine phosphatase
Class: hydrolase
Keywords: protein tyrosine phosphatase, hydrolase
Deposited on 1995-04-07, released 1995-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.174
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: yersinia protein tyrosine phosphatase
    Species: YERSINIA ENTEROCOLITICA [TaxId:630]
    Gene: YOP51
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15273 (0-277)
      • conflict (44)
      • conflict (212)
    Domains in SCOPe 2.07: d1ytsa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ytsA (A:)
    pearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlnanyiq
    vgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsgtygs
    itveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevtkalas
    lvdqtaetkrnmyeskgssavaddsklrpvihsragvgrtaqligamcmndsrnsqlsve
    dmvsqmrvqrngimvqkdeqldvliklaegqgrpllns