PDB entry 1ytq

View 1ytq on RCSB PDB site
Description: Structure of Native Human Beta B2 Crystallin
Class: Structural Protein
Keywords: Crystallin, Domain Swapping, greek key
Deposited on 2005-02-10, released 2006-01-31
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.181
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta crystallin B2
    Species: HOMO SAPIENS
    Gene: CRYBB2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ytqa1, d1ytqa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ytqA (A:)
    asdhqtqagkpqslnpkiiifeqenfqghshelngpcpnlketgvekagsvlvqagpwvg
    yeqanckgeqfvfekgeyprwdswtssrrtdslsslrpikvdsqehkiilyenpnftgkk
    meiidddvpsfhahgyqekvssvrvqsgtwvgyqypgyrglqyllekgdykdssdfgaph
    pqvqsvrrirdmqwhqrgafhpsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ytqA (A:)
    lnpkiiifeqenfqghshelngpcpnlketgvekagsvlvqagpwvgyeqanckgeqfvf
    ekgeyprwdswtssrrtdslsslrpikvdsqehkiilyenpnftgkkmeiidddvpsfha
    hgyqekvssvrvqsgtwvgyqypgyrglqyllekgdykdssdfgaphpqvqsvrrirdmq
    w