PDB entry 1ytp

View 1ytp on RCSB PDB site
Description: Solution structure of the C4A/C41A variant of the Nicotiana alata proteinase inhibitor T1
Class: hydrolase inhibitor
Keywords: beta-sheet, potII inhibitor, HYDROLASE INHIBITOR
Deposited on 2005-02-10, released 2006-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: proteinase inhibitor
    Species: Nicotiana alata [TaxId:4087]
    Database cross-references and differences (RAF-indexed):
    • GB AAA17739 (0-52)
      • engineered (3)
      • engineered (40)
    Domains in SCOPe 2.07: d1ytpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ytpA (A:)
    driatnccagtkgckyfsddgtfvcegesdprnpkacprnadpriaygicpla