PDB entry 1yto

View 1yto on RCSB PDB site
Description: Crystal Structure of Gly19 deletion Mutant of Human Acidic Fibroblast Growth Factor
Class: hormone/growth factor
Keywords: beta-trefoil, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2005-02-10, released 2006-01-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.198
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1ytoa_
  • Chain 'B':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1ytob_
  • Chain 'C':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1ytoc_
  • Chain 'D':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1ytod_
  • Heterogens: SO4, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ytoA (A:)
    hhhhhhfnlppgnykkpkllycsnghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevy
    ikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkng
    sckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ytoA (A:)
    hhhfnlppgnykkpkllycsnghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyiks
    tetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsck
    rgprthygqkailflplpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ytoB (B:)
    hhhhhhfnlppgnykkpkllycsnghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevy
    ikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkng
    sckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ytoB (B:)
    hhhhhfnlppgnykkpkllycsnghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyi
    kstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngs
    ckrgprthygqkailflplpv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ytoC (C:)
    hhhhhhfnlppgnykkpkllycsnghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevy
    ikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkng
    sckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ytoC (C:)
    hhhhhfnlppgnykkpkllycsnghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyi
    kstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngs
    ckrgprthygqkailflplpv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ytoD (D:)
    hhhhhhfnlppgnykkpkllycsnghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevy
    ikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkng
    sckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ytoD (D:)
    hhfnlppgnykkpkllycsnghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikst
    etgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckr
    gprthygqkailflplpv