PDB entry 1ytm

View 1ytm on RCSB PDB site
Description: Crystal structure of phosphoenolpyruvate carboxykinase of Anaerobiospirillum succiniciproducens complexed with ATP, oxalate, magnesium and manganese ions
Class: lyase
Keywords: kinase; domain closure; nucleotide binding; parallel beta sheet-like hydrogen bond, LYASE
Deposited on 2005-02-10, released 2006-01-24
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.215
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoenolpyruvate carboxykinase [ATP]
    Species: Anaerobiospirillum succiniciproducens [TaxId:13335]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ytma1, d1ytma2
  • Chain 'B':
    Compound: Phosphoenolpyruvate carboxykinase [ATP]
    Species: Anaerobiospirillum succiniciproducens [TaxId:13335]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ytmb1, d1ytmb2
  • Heterogens: MG, MN, ATP, OXD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ytmA (A:)
    mslseslakygitgatnivhnpsheelfaaetqaslegfekgtvtemgavnvmtgvytgr
    spkdkfivkneaskeiwwtsdefkndnkpvteeawaqlkalagkelsnkplyvvdlfcga
    nentrlkirfvmevawqahfvtnmfirpteeelkgfepdfvvlnaskakvenfkelglns
    etavvfnlaekmqiilntwyggemkkgmfsmmnfylplqgiaamhcsantdlegkntaif
    fglsgtgkttlstdpkrlligddehgwdddgvfnfeggcyakvinlskenepdiwgaikr
    nallenvtvdangkvdfadksvtentrvsypifhiknivkpvskapaakrviflsadafg
    vlppvsilskeqtkyyflsgftaklagtergiteptptfsscfgaafltlpptkyaevlv
    krmeasgakaylvntgwngtgkrisikdtrgiidaildgsidtantatipyfnftvptel
    kgvdtkildprntyadasewevkakdlaerfqknfkkfeslggdlvkagpql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ytmA (A:)
    slseslakygitgatnivhnpsheelfaaetqaslegfekgtvtemgavnvmtgvytgrs
    pkdkfivkneaskeiwwtsdefkndnkpvteeawaqlkalagkelsnkplyvvdlfcgan
    entrlkirfvmevawqahfvtnmfirpteeelkgfepdfvvlnaskakvenfkelglnse
    tavvfnlaekmqiilntwyggemkkgmfsmmnfylplqgiaamhcsantdlegkntaiff
    glsgtgkttlstdpkrlligddehgwdddgvfnfeggcyakvinlskenepdiwgaikrn
    allenvtvdangkvdfadksvtentrvsypifhiknivkpvskapaakrviflsadafgv
    lppvsilskeqtkyyflsgftaklagtergiteptptfsscfgaafltlpptkyaevlvk
    rmeasgakaylvntgwngtgkrisikdtrgiidaildgsidtantatipyfnftvptelk
    gvdtkildprntyadasewevkakdlaerfqknfkkf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ytmB (B:)
    mslseslakygitgatnivhnpsheelfaaetqaslegfekgtvtemgavnvmtgvytgr
    spkdkfivkneaskeiwwtsdefkndnkpvteeawaqlkalagkelsnkplyvvdlfcga
    nentrlkirfvmevawqahfvtnmfirpteeelkgfepdfvvlnaskakvenfkelglns
    etavvfnlaekmqiilntwyggemkkgmfsmmnfylplqgiaamhcsantdlegkntaif
    fglsgtgkttlstdpkrlligddehgwdddgvfnfeggcyakvinlskenepdiwgaikr
    nallenvtvdangkvdfadksvtentrvsypifhiknivkpvskapaakrviflsadafg
    vlppvsilskeqtkyyflsgftaklagtergiteptptfsscfgaafltlpptkyaevlv
    krmeasgakaylvntgwngtgkrisikdtrgiidaildgsidtantatipyfnftvptel
    kgvdtkildprntyadasewevkakdlaerfqknfkkfeslggdlvkagpql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ytmB (B:)
    slseslakygitgatnivhnpsheelfaaetqaslegfekgtvtemgavnvmtgvytgrs
    pkdkfivkneaskeiwwtsdefkndnkpvteeawaqlkalagkelsnkplyvvdlfcgan
    entrlkirfvmevawqahfvtnmfirpteeelkgfepdfvvlnaskakvenfkelglnse
    tavvfnlaekmqiilntwyggemkkgmfsmmnfylplqgiaamhcsantdlegkntaiff
    glsgtgkttlstdpkrlligddehgwdddgvfnfeggcyakvinlskenepdiwgaikrn
    allenvtvdangkvdfadksvtentrvsypifhiknivkpvskapaakrviflsadafgv
    lppvsilskeqtkyyflsgftaklagtergiteptptfsscfgaafltlpptkyaevlvk
    rmeasgakaylvntgwngtgkrisikdtrgiidaildgsidtantatipyfnftvptelk
    gvdtkildprntyadasewevkakdlaerfqknfkkf