PDB entry 1ytl

View 1ytl on RCSB PDB site
Description: Crystal Structure of Acetyl-CoA decarboxylase/synthase complex epsilon subunit 2
Class: structural genomics, unknown function
Keywords: Structural Genomics, Acetyl-CoA decarboxylase-synthase complex, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2005-02-10, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.173
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetyl-CoA decarboxylase/synthase complex epsilon subunit 2
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: cdhB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ytla1
  • Chain 'B':
    Compound: Acetyl-CoA decarboxylase/synthase complex epsilon subunit 2
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: cdhB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ytlb_
  • Chain 'C':
    Compound: Acetyl-CoA decarboxylase/synthase complex epsilon subunit 2
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: cdhB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ytlc_
  • Chain 'D':
    Compound: Acetyl-CoA decarboxylase/synthase complex epsilon subunit 2
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: cdhB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ytld_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ytlA (A:)
    akaleqpfdvanipgpkmatllekgkpvanmikkakrpllivgpdmtdemfervkkfvek
    ditvvatgsaitrfidaglgekvnyavlheltqflldpdwkgfdgqgnydlvlmlgsiyy
    hgsqmlaaiknfaphiralaidryyhpnadmsfgnlwkkeedylklldeilael
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ytlA (A:)
    kmatllekgkpvanmikkakrpllivgpdmtdemfervkkfvekditvvatgsaitrfid
    aglgekvnyavlheltqflldpdwkgfdgqgnydlvlmlgsiyyhgsqmlaaiknfaphi
    ralaidryyhpnadmsfgnlwkkeedylklldeilael
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ytlB (B:)
    akaleqpfdvanipgpkmatllekgkpvanmikkakrpllivgpdmtdemfervkkfvek
    ditvvatgsaitrfidaglgekvnyavlheltqflldpdwkgfdgqgnydlvlmlgsiyy
    hgsqmlaaiknfaphiralaidryyhpnadmsfgnlwkkeedylklldeilael
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ytlB (B:)
    kmatllekgkpvanmikkakrpllivgpdmtdemfervkkfvekditvvatgsaitrfid
    aglgekvnyavlheltqflldpdwkgfdgqgnydlvlmlgsiyyhgsqmlaaiknfaphi
    ralaidryyhpnadmsfgnlwkkeedylklldeilael
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ytlC (C:)
    akaleqpfdvanipgpkmatllekgkpvanmikkakrpllivgpdmtdemfervkkfvek
    ditvvatgsaitrfidaglgekvnyavlheltqflldpdwkgfdgqgnydlvlmlgsiyy
    hgsqmlaaiknfaphiralaidryyhpnadmsfgnlwkkeedylklldeilael
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ytlC (C:)
    matllekgkpvanmikkakrpllivgpdmtdemfervkkfvekditvvatgsaitrfida
    glgekvnyavlheltqflldpdwkgfdgqgnydlvlmlgsiyyhgsqmlaaiknfaphir
    alaidryyhpnadmsfgnlwkkeedylklldeilael
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ytlD (D:)
    akaleqpfdvanipgpkmatllekgkpvanmikkakrpllivgpdmtdemfervkkfvek
    ditvvatgsaitrfidaglgekvnyavlheltqflldpdwkgfdgqgnydlvlmlgsiyy
    hgsqmlaaiknfaphiralaidryyhpnadmsfgnlwkkeedylklldeilael
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ytlD (D:)
    kmatllekgkpvanmikkakrpllivgpdmtdemfervkkfvekditvvatgsaitrfid
    aglgekvnyavlheltqflldpdwkgfdgqgnydlvlmlgsiyyhgsqmlaaiknfaphi
    ralaidryyhpnadmsfgnlwkkeedylklldeilael