PDB entry 1ytk

View 1ytk on RCSB PDB site
Description: Crystal structure of a nicotinate phosphoribosyltransferase from Thermoplasma acidophilum with nicotinate mononucleotide
Class: Transferase
Keywords: nicotinate phosphoribosyltransferase, type II phosphoribosyltransferase, zinc-knuckle motif, Structural Genomics, PSI, Protein Structure Initiative, Berkeley Structural Genomics Center, BSGC, Transferase
Deposited on 2005-02-10, released 2005-03-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.201
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nicotinate phosphoribosyltransferase from Thermoplasma acidophilum
    Species: THERMOPLASMA ACIDOPHILUM [TaxId:273075]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ytka1, d1ytka2
  • Heterogens: NCN, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ytkA (A:)
    ggggggmnvfntasdedikkglasdvyfertisaigdkcndlrvameatvsgpldtwinf
    tgldevlkllegldvdlyaipegtilfprdanglpvpfirvegrycdfgmyetailgfic
    qasgistkaskvrlaagdspffsfgirrmhpaispmidrsayiggadgvsgilgaklidq
    dpvgtmphalsimlgdeeawkltlentkngqksvllidtymdekfaaikiaemfdkvdyi
    rldtpssrrgnfealirevrwelalrgrsdikimvsggldentvkklreagaeafgvgts
    issakpfdfamdivevngkpetkrgkmsgrknvlrctschrievvpanvqektcicggsm
    qnllvkylshgkrtseyprpkeirsrsmkeleyfkdis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ytkA (A:)
    mnvfntasdedikkglasdvyfertisaigdkcndlrvameatvsgpldtwinftgldev
    lkllegldvdlyaipegtilfprdanglpvpfirvegrycdfgmyetailgficqasgis
    tkaskvrlaagdspffsfgirrmhpaispmidrsayiggadgvsgilgaklidqdpvgtm
    phalsimlgdeeawkltlentkngqksvllidtymdekfaaikiaemfdkvdyirldtps
    srrgnfealirevrwelalrgrsdikimvsggldentvkklreagaeafgvgtsissakp
    fdfamdivevngkpetkrgkmsgrknvlrctschrievvpanvqektcicggsmqnllvk
    ylshgkrtseyprpkeirsrsmkeleyfk