PDB entry 1ytj

View 1ytj on RCSB PDB site
Description: siv protease crystallized with peptide product
Class: hydrolase/peptide
Keywords: aids, polyprotein, hydrolase, aspartyl protease, endonuclease, RNA-directed DNA polymerase, hydrolase-peptide complex
Deposited on 1996-08-01, released 1997-03-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.174
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: siv protease
    Species: Simian immunodeficiency virus [TaxId:11723]
    Gene: SIV(MAC)239
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05896 (0-97)
      • engineered (3)
      • conflict (6)
      • conflict (63)
    Domains in SCOPe 2.07: d1ytja_
  • Chain 'I':
    Compound: peptide product
    Database cross-references and differences (RAF-indexed):
    • PDB 1YTJ (0-4)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ytjA (A:)
    pqfhlwkrpvvtahiegqpvevlldtgaddsivtgielgphytpkivggiggfintkeyk
    nvevevlgkrikgtimtgdtpinifgrnlltalgmslnf
    

  • Chain 'I':
    No sequence available.