PDB entry 1ytj

View 1ytj on RCSB PDB site
Description: siv protease crystallized with peptide product
Deposited on 1996-08-01, released 1997-03-12
The last revision prior to the SCOP 1.63 freeze date was dated 1997-03-12, with a file datestamp of 1997-03-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.174
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1ytja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ytjA (A:)
    pqfhlwkrpvvtahiegqpvevlldtgaddsivtgielgphytpkivggiggfintkeyk
    nvevevlgkrikgtimtgdtpinifgrnlltalgmslnf