PDB entry 1ytg

View 1ytg on RCSB PDB site
Description: siv protease crystallized with peptide product
Class: hydrolase/peptide
Keywords: aids, polyprotein, hydrolase, aspartyl protease, endonuclease, RNA-directed DNA polymerase, hydrolase-peptide complex
Deposited on 1996-08-01, released 1997-03-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.179
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: STRAIN SF-2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • engineered (6)
  Domains in SCOPe 2.08: d1ytga_
• Chain 'B':
  Compound: hiv protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: STRAIN SF-2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • engineered (6)
  Domains in SCOPe 2.08: d1ytgb_
• Chain 'I':
  Compound: peptide product
  Database cross-references and differences (RAF-indexed):
  • PDB 1YTG (0-End)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ytgA (A:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipveicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ytgB (B:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipveicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'I':
  No sequence available.