PDB entry 1ytf

View 1ytf on RCSB PDB site
Description: yeast tfiia/tbp/DNA complex
Class: transcription/DNA
Keywords: transcription regulation, DNA, complex, transcription/DNA complex
Deposited on 1996-04-05, released 1996-06-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.235
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (tata binding protein (tbp))
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ytfa1, d1ytfa2
  • Chain 'B':
    Compound: protein (transcription factor iia - toa1n subunit)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ytfb_
  • Chain 'C':
    Compound: protein (transcription factor iia - toa1c subunit)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ytfc_
  • Chain 'D':
    Compound: protein (transcription factor iia - toa2 subunit)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ytfd1, d1ytfd2
  • Chain 'E':
    Compound: DNA (5'-d(*tp*gp*tp*ap*tp*gp*tp*ap*tp*ap*tp*ap*ap*ap*ap*c)-3')
    Species:
    Gene:
  • Chain 'F':
    Compound: DNA (5'-d(*gp*tp*tp*tp*tp*ap*tp*ap*tp*ap*cp*ap*tp*ap*cp*a)-3')
    Species:
    Gene:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ytfA (A:)
    sgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk
    mvvtgakseddsklasrkyariiqkigfaakftdfkiqnivgscdvkfpirleglafshg
    tfssyepelfpgliyrmvkpkivllifvsgkivltgakqreeiyqafeaiypvlsefrkm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ytfB (B:)
    snaeasrvyeiivesvvnevredfenagideqtlqdlkniwqkkltetkvttf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ytfB (B:)
    snaeasrvyeiivesvvnevredfenagideqtlqdlkniwqkklt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ytfC (C:)
    gssalldtdevgselddsdddylisegeedgpdenlmlclydkvtrtkarwkcslkdgvv
    tinrndytfqkaqveaewv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ytfC (C:)
    enlmlclydkvtrtkarwkcslkdgvvtinrndytfqkaqveaewv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ytfD (D:)
    avpgyyelyrrstignslvdaldtlisdgrieaslamrvletfdkvvaetlkdntqsklt
    vkgnldtygfcddvwtfivkncqvtvedshrdasqngsgdsqsvisvdklrivacnskks
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ytfD (D:)
    gyyelyrrstignslvdaldtlisdgrieaslamrvletfdkvvaetlkdntqskltvkg
    nldtygfcddvwtfivkncqvtvesvisvdklrivacnsk
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.