PDB entry 1ytf

View 1ytf on RCSB PDB site
Description: yeast tfiia/tbp/dna complex
Deposited on 1996-04-05, released 1996-06-20
The last revision prior to the SCOP 1.55 freeze date was dated 1999-05-11, with a file datestamp of 1999-05-10.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.235
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ytfA (A:)
    sgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk
    mvvtgakseddsklasrkyariiqkigfaakftdfkiqnivgscdvkfpirleglafshg
    tfssyepelfpgliyrmvkpkivllifvsgkivltgakqreeiyqafeaiypvlsefrkm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ytfB (B:)
    snaeasrvyeiivesvvnevredfenagideqtlqdlkniwqkklt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ytfC (C:)
    enlmlclydkvtrtkarwkcslkdgvvtinrndytfqkaqveaewv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ytfD (D:)
    gyyelyrrstignslvdaldtlisdgrieaslamrvletfdkvvaetlkdntqskltvkg
    nldtygfcddvwtfivkncqvtvedshrdasqngsgdsqsvisvdklrivacnsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ytfD (D:)
    gyyelyrrstignslvdaldtlisdgrieaslamrvletfdkvvaetlkdntqskltvkg
    nldtygfcddvwtfivkncqvtvesvisvdklrivacnsk