PDB entry 1ytc

View 1ytc on RCSB PDB site
Description: thermodynamic cycles as probes of structure-function relationships in unfolded proteins
Class: electron transport
Keywords: electron transport, heme protein
Deposited on 1995-07-03, released 1996-03-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-03, with a file datestamp of 2021-02-26.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: yeast iso-2 cytochrome c
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00045 (0-111)
      • engineered (60)
    Domains in SCOPe 2.08: d1ytca_
  • Heterogens: SO4, HEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ytcA (A:)
    akestgfkpgsakkgatlfktrcqqchtieeggpnkvgpnlhgifgrhsgqvkgysytda
    iinknvkwdedsmseyltnpkkyipgtkmafaglkkekdrndlitymtkaak