PDB entry 1ytb

View 1ytb on RCSB PDB site
Description: crystal structure of a yeast tbp/tata-box complex
Class: transcription/DNA
Keywords: protein-DNA complex, transcription/DNA complex
Deposited on 1994-09-28, released 1995-01-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.201
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (tata binding protein (tbp))
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ytba1, d1ytba2
  • Chain 'B':
    Compound: protein (tata binding protein (tbp))
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ytbb1, d1ytbb2
  • Chain 'C':
    Compound: DNA (29mer)
  • Chain 'D':
    Compound: DNA (29mer)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ytbA (A:)
    sgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk
    mvvtgakseddsklasrkyariiqkigfaakftdfkiqnivgscdvkfpirleglafshg
    tfssyepelfpgliyrmvkpkivllifvsgkivltgakqreeiyqafeaiypvlsefrkm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ytbB (B:)
    sgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk
    mvvtgakseddsklasrkyariiqkigfaakftdfkiqnivgscdvkfpirleglafshg
    tfssyepelfpgliyrmvkpkivllifvsgkivltgakqreeiyqafeaiypvlsefrkm
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.