PDB entry 1ytb

View 1ytb on RCSB PDB site
Description: crystal structure of a yeast tbp/tata-box complex
Deposited on 1994-09-28, released 1995-01-26
The last revision prior to the SCOP 1.59 freeze date was dated 1995-01-26, with a file datestamp of 1995-02-03.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.201
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ytbA (A:)
    sgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk
    mvvtgakseddsklasrkyariiqkigfaakftdfkiqnivgscdvkfpirleglafshg
    tfssyepelfpgliyrmvkpkivllifvsgkivltgakqreeiyqafeaiypvlsefrkm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ytbB (B:)
    sgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk
    mvvtgakseddsklasrkyariiqkigfaakftdfkiqnivgscdvkfpirleglafshg
    tfssyepelfpgliyrmvkpkivllifvsgkivltgakqreeiyqafeaiypvlsefrkm