PDB entry 1yt8

View 1yt8 on RCSB PDB site
Description: Crystal Structure of Thiosulfate sulfurtransferase from Pseudomonas aeruginosa
Class: transferase
Keywords: thiosulfate sulfurtransferase, Rhodanase domains, Cyanide detoxification, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, TRANSFERASE
Deposited on 2005-02-10, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.185
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thiosulfate sulfurtransferase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I0N4 (Start-528)
      • see remark 999 (83)
      • modified residue (160)
      • modified residue (336)
      • modified residue (344)
      • modified residue (503)
      • expression tag (529)
    Domains in SCOPe 2.07: d1yt8a1, d1yt8a2, d1yt8a3, d1yt8a4, d1yt8a5
  • Heterogens: SO3, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yt8A (A:)
    mslsqiavrtfhdiraallarrelalldvreedpfaqahplfaanlplsrleleiharvp
    rrdtpitvyddgeglapvaaqrlhdlgysdvalldgglsgwrnaggelfrdvnvpskafg
    elveaerhtpslaaeevqalldaraeavildarrfdeyqtmsipggisvpgaelvlrvae
    lapdprtrvivncagrtrsiigtqsllnagipnpvaalrngtigwtlagqqlehgqtrrf
    gaisqdtrkaaaqraravadragverldlaglaqwqdehdrttylldvrtpeeyeaghlp
    gsrstpggqlvqetdhvasvrgarlvlvdddgvranmsaswlaqmgwqvavldglseadf
    sergawsaplprqpradtidpttladwlgepgtrvldftasanyakrhipgaawvlrsql
    kqalerlgtaeryvltcgssllarfavaevqalsgkpvflldggtsawvaaglptedges
    llaspridryrrpyegtdnpreamqgyldwefglveqlgrdgthgffvieggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yt8A (A:)
    iavrtfhdiraallarrelalldvreedpfaqahplfaanlplsrleleiharvprrdtp
    itvyddgeglapvaaqrlhdlgysdvalldgglsgwrnaggelfrdvnvpskafgelvea
    erhtpslaaeevqalldaraeavildarrfdeyqtmsipggisvpgaelvlrvaelapdp
    rtrvivncagrtrsiigtqsllnagipnpvaalrngtigwtlagqqlehgqtrrfgaisq
    dtrkaaaqraravadragverldlaglaqwqdehdrttylldvrtpeeyeaghlpgsrst
    pggqlvqetdhvasvrgarlvlvdddgvranmsaswlaqmgwqvavldglseadfserga
    wsaplprqpradtidpttladwlgepgtrvldftasanyakrhipgaawvlrsqlkqale
    rlgtaeryvltcgssllarfavaevqalsgkpvflldggtsawvaaglptedgesllasp
    ridryrrpyegtdnpreamqgyldwefglveqlgrdgthgffvie