PDB entry 1yt7

View 1yt7 on RCSB PDB site
Description: Cathepsin K complexed with a constrained ketoamide inhibitor
Class: hydrolase
Keywords: cathepsin, cysteine protease, HYDROLASE
Deposited on 2005-02-10, released 2005-07-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.183
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin k
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSK, CTSO, CTSO2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1yt7a_
  • Heterogens: SO4, 3FC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yt7A (A:)
    apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
    dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
    lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
    knswgenwgnkgyilmarnknnacgianlasfpkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yt7A (A:)
    pdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsend
    gcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegnekal
    kravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwiik
    nswgenwgnkgyilmarnknnacgianlasfpkm