PDB entry 1yt5

View 1yt5 on RCSB PDB site
Description: crystal structure of nad kinase from thermotoga maritima
Deposited on 2005-02-09, released 2005-04-05
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inorganic polyphosphate/ATP-NAD kinase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: ppnK
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Inorganic polyphosphate/ATP-NAD kinase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: ppnK
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Inorganic polyphosphate/ATP-NAD kinase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: ppnK
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Inorganic polyphosphate/ATP-NAD kinase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: ppnK
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1yt5A (A:)
    mkiailyreerekegeflkekiskeheviefgeanapgrvtadlivvvggdgtvlkaakk
    aadgtpmvgfkagrlgfltsytldeidrfledlrnwnfreetrwfiqieselgnhlalnd
    vtlerdlsgkmveievevehhssmwffadgvvistptgstayslsiggpiifpecevlei
    spiapqffltrsvvipsnfkvvvesqrdinmlvdgvltgktkrievkksrryvrilrppe
    ydyvtvirdklgygrrie
    

    Sequence, based on observed residues (ATOM records):
    >1yt5A (A:)
    mkiailyreerekegeflkekiskeheviefgeanapgrvtadlivvvggdgtvlkaakk
    aadgtpmvgfkagrlgfltsytldeidrfledlrnwnfreetrwfiqieselgnhlalnd
    vtlerdlsgkmveievevehhssmwffadgvvistptgstayslsiggpiifpecevlei
    spiapqffltrsvvipsnfkvvvesqrdinmlvdgvltgktkrievkksrryvrilrppe
    ydyvtvirdklgygrr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1yt5B (B:)
    mkiailyreerekegeflkekiskeheviefgeanapgrvtadlivvvggdgtvlkaakk
    aadgtpmvgfkagrlgfltsytldeidrfledlrnwnfreetrwfiqieselgnhlalnd
    vtlerdlsgkmveievevehhssmwffadgvvistptgstayslsiggpiifpecevlei
    spiapqffltrsvvipsnfkvvvesqrdinmlvdgvltgktkrievkksrryvrilrppe
    ydyvtvirdklgygrrie
    

    Sequence, based on observed residues (ATOM records):
    >1yt5B (B:)
    mkiailyreerekegeflkekiskeheviefgeanapgrvtadlivvvggdgtvlkaakk
    aadgtpmvgfkagrlgfltsytldeidrfledlrnwnfreetrwfiqieselgnhlalnd
    vtlerdlsgkmveievevehhssmwffadgvvistptgstayslsiggpiifpecevlei
    spiapqffltrsvvipsnfkvvvesqrdinmlvdgvltgktkrievkksrryvrilrppe
    ydyvtvirdklgygrr
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1yt5C (C:)
    mkiailyreerekegeflkekiskeheviefgeanapgrvtadlivvvggdgtvlkaakk
    aadgtpmvgfkagrlgfltsytldeidrfledlrnwnfreetrwfiqieselgnhlalnd
    vtlerdlsgkmveievevehhssmwffadgvvistptgstayslsiggpiifpecevlei
    spiapqffltrsvvipsnfkvvvesqrdinmlvdgvltgktkrievkksrryvrilrppe
    ydyvtvirdklgygrrie
    

    Sequence, based on observed residues (ATOM records):
    >1yt5C (C:)
    mkiailyreerekegeflkekiskeheviefgeanapgrvtadlivvvggdgtvlkaakk
    aadgtpmvgflgfltsytldeidrfledlrnwnfreetrwfiqieselgnhlalndvtle
    rdlsgkmveievevehhssmwffadgvvistptgstayslsiggpiifpecevleispia
    pqffltrsvvipsnfkvvvesqrdinmlvdgvltgktkrievkksrryvrilrppeydyv
    tvirdklgygrr
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1yt5D (D:)
    mkiailyreerekegeflkekiskeheviefgeanapgrvtadlivvvggdgtvlkaakk
    aadgtpmvgfkagrlgfltsytldeidrfledlrnwnfreetrwfiqieselgnhlalnd
    vtlerdlsgkmveievevehhssmwffadgvvistptgstayslsiggpiifpecevlei
    spiapqffltrsvvipsnfkvvvesqrdinmlvdgvltgktkrievkksrryvrilrppe
    ydyvtvirdklgygrrie
    

    Sequence, based on observed residues (ATOM records):
    >1yt5D (D:)
    mkiailyreerekegeflkekiskeheviefgeanapgrvtadlivvvggdgtvlkaakk
    aadgtpmvgfkagrlgfltsytldeidrfledlrnwnfreetrwfiqieselgnhlalnd
    vtlerdlsgkmveievevehhssmwffadgvvistptgstayslsiggpiifpecevlei
    spiapqffltrsvvipsnfkvvvesqrdinmlvdgvltgktkrievkksrryvrilrppe
    ydyvtvirdklgygrr