PDB entry 1yt2

View 1yt2 on RCSB PDB site
Description: Crystal Structure of the Unliganded Form of GRP94, the ER Hsp90: Basis for Nucleotide-Induced Conformational Change, GRP94N APO CRYSTAL
Class: chaperone
Keywords: GRP94, gp96, Hsp90, Bergerat, Chaperone, Endoplasmic reticulum, HtpG
Deposited on 2005-02-09, released 2005-06-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.25 Å
R-factor: 0.252
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoplasmin
    Species: Canis lupus familiaris [TaxId:9615]
    Gene: TRA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1yt2a1
  • Heterogens: PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yt2A (A:)
    gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
    alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqed
    gqstseligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrg
    ttitlvlkeeasdyleldtiknlvkkysqfinfpiyvwssktetveepmeeeeaakeeke
    dsddeaaveeeeeekkpktkkvektvwdwelmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yt2A (A:)
    sekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagneel
    tvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqedgqstseli
    gqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvlk
    eeasdyleldtiknlvkkysqfinfpiyvwssktektvwdwelmn