PDB entry 1ysy

View 1ysy on RCSB PDB site
Description: NMR Structure of the nonstructural Protein 7 (nsP7) from the SARS CoronaVirus
Class: Viral protein
Keywords: helix bundle, Structural Genomics, PSI, Protein Structure Initiative, Joint Center for Structural Genomics, JCSG, Viral protein
Deposited on 2005-02-09, released 2005-12-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Replicase polyprotein 1ab (pp1ab) (ORF1AB)
  Species: SARS coronavirus [TaxId:227859]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59641 (2-84)
    • cloning artifact (0-1)
  Domains in SCOPe 2.08: d1ysya1, d1ysya2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ysyA (A:)
  ghskmsdvkctsvvllsvlqqlrvesssklwaqcvqlhndillakdtteafekmvsllsv
  llsmqgavdinrlceemldnratlq