PDB entry 1ysw

View 1ysw on RCSB PDB site
Description: Solution structure of the anti-apoptotic protein Bcl-2 complexed with an acyl-sulfonamide-based ligand
Class: apoptosis
Keywords: complex, apoptosis
Deposited on 2005-02-09, released 2005-06-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-11-17, with a file datestamp of 2009-11-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Apoptosis regulator Bcl-2
    Species: Homo sapiens [TaxId:9606]
    Gene: BCL2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10415 (0-31)
      • insertion (31-47)
    • Uniprot P10415 (48-162)
    Domains in SCOPe 2.08: d1yswa2, d1yswa3
  • Heterogens: 43B

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yswA (A:)
    hagrtgydnreivmkyihyklsqrgyewdagddveenrteapegtesevvhltlrqagdd
    fsrryrrdfaemssqlhltpftargrfatvveelfrdgvnwgrivaffefggvmcvesvn
    remsplvdnialwmteylnrhlhtwiqdnggwdafvelygpsmr