PDB entry 1ysp

View 1ysp on RCSB PDB site
Description: Crystal structure of the C-terminal domain of E. coli transcriptional regulator KdgR.
Class: transcription
Keywords: transcriptional regulator, KdgR, IclR, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, TRANSCRIPTION
Deposited on 2005-02-08, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.214
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator kdgR
    Species: Escherichia coli [TaxId:562]
    Gene: kdgR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P76268 (3-End)
      • cloning artifact (2)
    Domains in SCOPe 2.07: d1yspa1, d1yspa2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yspA (A:)
    ghmdlirsadiqmrelsrltketihlgaldedsivyihkidsmynlrmysrigrrnplys
    taigkvllawrdrdevkqilegveykrstertitsteallpvldqvreqgygedneeqee
    glrciavpvfdrfgvviaglsisfptlrfseerlqeyvamlhtaarkisaqmgyhdypfg
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yspA (A:)
    mdlirsadiqmrelsrltketihlgaldedsivyihkidsmigrrnplystaigkvllaw
    rdrdevkqilegveykrstertitsteallpvldqvreqgygedneeqeeglrciavpvf
    drfgvviaglsisfptlrfseerlqeyvamlhtaarkisaqmgy