PDB entry 1yso

View 1yso on RCSB PDB site
Description: yeast cu, zn superoxide dismutase with the reduced bridge broken
Class: oxidoreductase (superoxide acceptor)
Keywords: oxidoreductase (superoxide acceptor), copper, zinc
Deposited on 1995-12-21, released 1996-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: yeast cu, zn superoxide dismutase
  Species: Candida albicans [TaxId:5476]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00445 (0-152)
  Domains in SCOPe 2.08: d1ysoa_
• Heterogens: CU1, ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ysoA (A:)
  vqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhihefgdatngcvsa
  gphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvih
  agqddlgkgdteeslktgnagprpacgvigltn