PDB entry 1ysn

View 1ysn on RCSB PDB site
Description: Solution structure of the anti-apoptotic protein Bcl-xL complexed with an acyl-sulfonamide-based ligand
Class: apoptosis
Keywords: Complex, APOPTOSIS
Deposited on 2005-02-08, released 2005-06-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: apoptosis regulator bcl-x
  Species: Homo sapiens [TaxId:9606]
  Gene: BCL2L1, BCL2L, BCLX
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q07817 (4-47)
    • cloning artifact (0-3)
    • cloning artifact (173-179)
    • cloning artifact (140)
  • Uniprot Q07817 (48-172)
  Domains in SCOPe 2.08: d1ysna2, d1ysna3, d1ysna4
• Heterogens: 43B

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ysnA (A:)
  msmamsqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagde
  felryrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvd
  kemqvlvsriaawmatylndhlepwiqenggwdtfvelygnnaaaesrkgqerlehhhhh
  h