PDB entry 1ysm

View 1ysm on RCSB PDB site
Description: NMR Structure of N-terminal domain (Residues 1-77) of Siah-Interacting Protein.
Class: Metal Binding Protein
Keywords: helix-turn-helix, Metal Binding Protein
Deposited on 2005-02-08, released 2005-07-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcyclin-binding protein
    Species: Mus musculus [TaxId:10090]
    Gene: Cacybp, Sip
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ysma1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ysmA (A:)
    masvleelqkdleevkvllekstrkrlrdtltsekskietelknkmqqksqkkpeldnek
    paavvaplttgytvkis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ysmA (A:)
    masvleelqkdleevkvllekstrkrlrdtltsekskietelknkmqqksqkkpe