PDB entry 1ysl

View 1ysl on RCSB PDB site
Description: Crystal structure of HMG-CoA synthase from Enterococcus faecalis with AcetoAcetyl-CoA ligand.
Class: lyase
Keywords: Thiolase family, CoEnzymeA, LYASE
Deposited on 2005-02-08, released 2005-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.179
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HMG-CoA synthase
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • GB AAG02438 (19-401)
    Domains in SCOPe 2.07: d1ysla1, d1ysla2
  • Chain 'B':
    Compound: HMG-CoA synthase
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • GB AAG02438 (19-401)
      • microheterogeneity (129)
    Domains in SCOPe 2.07: d1yslb1, d1yslb2
  • Heterogens: SO4, GOL, COA, AAE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yslA (A:)
    mgshhhhhhssglvprgshmtigidkisffvppyyidmtalaearnvdpgkfhigigqdq
    mavnpisqdivtfaanaaeailtkedkeaidmvivgtessideskaaavvlhrlmgiqpf
    arsfeikeacygataglqlaknhvalhpdkkvlvvaadiakyglnsggeptqgagavaml
    vaseprilalkednvmltqdiydfwrptghpypmvdgplsnetyiqsfaqvwdehkkrtg
    ldfadydalafhipytkmgkkallakisdqteaeqerilaryeesiiysrrvgnlytgsl
    ylglisllenattltagnqiglfsygsgavaefftgelvagyqnhlqkethlalldnrte
    lsiaeyeamfaetldtdidqtledelkysisainntvrsyrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yslA (A:)
    mtigidkisffvppyyidmtalaearnvdpgkfhigigqdqmavnpisqdivtfaanaae
    ailtkedkeaidmvivgtessideskaaavvlhrlmgiqpfarsfeikeacygataglql
    aknhvalhpdkkvlvvaadiakyglnsggeptqgagavamlvaseprilalkednvmltq
    diydfwrptghpypmvdgplsnetyiqsfaqvwdehkkrtgldfadydalafhipytkmg
    kkallakisdqteaeqerilaryeesiiysrrvgnlytgslylglisllenattltagnq
    iglfsygsgavaefftgelvagyqnhlqkethlalldnrtelsiaeyeamfaetldtdid
    qtledelkysisainntvrsyrn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yslB (B:)
    mgshhhhhhssglvprgshmtigidkisffvppyyidmtalaearnvdpgkfhigigqdq
    mavnpisqdivtfaanaaeailtkedkeaidmvivgtessideskaaavvlhrlmgiqpf
    arsfeikeacygataglqlaknhvalhpdkkvlvvaadiakyglnsggeptqgagavaml
    vaseprilalkednvmltqdiydfwrptghpypmvdgplsnetyiqsfaqvwdehkkrtg
    ldfadydalafhipytkmgkkallakisdqteaeqerilaryeesiiysrrvgnlytgsl
    ylglisllenattltagnqiglfsygsgavaefftgelvagyqnhlqkethlalldnrte
    lsiaeyeamfaetldtdidqtledelkysisainntvrsyrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yslB (B:)
    mtigidkisffvppyyidmtalaearnvdpgkfhigigqdqmavnpisqdivtfaanaae
    ailtkedkeaidmvivgtessideskaaavvlhrlmgiqpfarsfeikeacygataglql
    aknhvalhpdkkvlvvaadiakyglnsggeptqgagavamlvaseprilalkednvmltq
    diydfwrptghpypmvdgplsnetyiqsfaqvwdehkkrtgldfadydalafhipytkmg
    kkallakisdqteaeqerilaryeesiiysrrvgnlytgslylglisllenattltagnq
    iglfsygsgavaefftgelvagyqnhlqkethlalldnrtelsiaeyeamfaetldtdid
    qtledelkysisainntvrsyrn