PDB entry 1ysj

View 1ysj on RCSB PDB site
Description: Crystal Structure of Bacillus Subtilis YXEP Protein (APC1829), a Dinuclear Metal Binding Peptidase from M20 Family
Class: hydrolase
Keywords: M20 family Peptidase, Dinuclear Metal Binding, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, HYDROLASE
Deposited on 2005-02-08, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.185
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein yxeP
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yxeP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54955
      • modified residue (36)
      • engineered (77)
      • modified residue (118)
      • modified residue (135)
      • modified residue (180)
      • modified residue (199)
      • modified residue (272)
      • modified residue (291)
      • modified residue (364)
    Domains in SCOPe 2.07: d1ysja1, d1ysja2
  • Chain 'B':
    Compound: protein yxeP
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yxeP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54955
      • modified residue (36)
      • engineered (77)
      • modified residue (118)
      • modified residue (135)
      • modified residue (180)
      • modified residue (199)
      • modified residue (272)
      • modified residue (291)
      • modified residue (364)
    Domains in SCOPe 2.07: d1ysjb1, d1ysjb2
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ysjA (A:)
    mhhhhhhssgvdlgtenlyfqsnamadkafhtrlinmrrdlhehpelsfqevettkkirr
    wleeeqieildvpqlktgviaeikgredgpviairadidalpiqeqtnlpfaskvdgtmh
    acghdfhtasiigtamllnqrraelkgtvrfifqpaeeiaagarkvleagvlngvsaifg
    mhnkpdlpvgtigvkegplmasvdrfeivikgkgghasipnnsidpiaaagqiisglqsv
    vsrnisslqnavvsitrvqagtswnvipdqaemegtvrtfqkearqavpehmrrvaegia
    agygaqaefkwfpylpsvqndgtflnaaseaaarlgyqtvhaeqspggedfalyqekipg
    ffvwmgtngteewhhpaftldeealtvasqyfaelavivletik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ysjA (A:)
    adkafhtrlinmrrdlhehpelsfqevettkkirrwleeeqieildvpqlktgviaeikg
    redgpviairadidalpiqeqtnlpfaskvdgtmhacghdfhtasiigtamllnqrrael
    kgtvrfifqpaeeiaagarkvleagvlngvsaifgmhnkpdlpvgtigvkegplmasvdr
    feivikgknsidpiaaagqiisglqnavvsitrvqagtswnvipdqaemegtvrtfqkea
    rqavpehmrrvaegiaagygaqaefkwfpylpsvqndgtflnaaseaaarlgyqtvhaeq
    spggedfalyqekipgffvwmgtngteewhhpaftldeealtvasqyfaelavivleti
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ysjB (B:)
    mhhhhhhssgvdlgtenlyfqsnamadkafhtrlinmrrdlhehpelsfqevettkkirr
    wleeeqieildvpqlktgviaeikgredgpviairadidalpiqeqtnlpfaskvdgtmh
    acghdfhtasiigtamllnqrraelkgtvrfifqpaeeiaagarkvleagvlngvsaifg
    mhnkpdlpvgtigvkegplmasvdrfeivikgkgghasipnnsidpiaaagqiisglqsv
    vsrnisslqnavvsitrvqagtswnvipdqaemegtvrtfqkearqavpehmrrvaegia
    agygaqaefkwfpylpsvqndgtflnaaseaaarlgyqtvhaeqspggedfalyqekipg
    ffvwmgtngteewhhpaftldeealtvasqyfaelavivletik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ysjB (B:)
    dkafhtrlinmrrdlhehpelsfqevettkkirrwleeeqieildvpqlktgviaeikgr
    edgpviairadidalpiqeqtnlpfaskvdgtmhacghdfhtasiigtamllnqrraelk
    gtvrfifqpaeeiaagarkvleagvlngvsaifgmhnkpdlpvgtigvkegplmasvdrf
    eivikgkidpiaaagqiisglqnavvsitrvqagtswnvipdqaemegtvrtfqkearqa
    vpehmrrvaegiaagygaqaefkwfpylpsvqndgtflnaaseaaarlgyqtvhaeqspg
    gedfalyqekipgffvwmgtngteewhhpaftldeealtvasqyfaelavivleti