PDB entry 1ysh

View 1ysh on RCSB PDB site
Description: localization and dynamic behavior of ribosomal protein l30e
Deposited on 2005-02-08, released 2005-07-05
The last revision was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: EM
Resolution: 9.5 Å
R-factor: N/A
AEROSPACI score: -0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA (28-mer)
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'B':
    Compound: RNA (101-mer)
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'C':
    Compound: ribosomal protein l30
    Species: Triticum aestivum [TaxId:4565]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5I7K9 (0-103)
      • see remark 999 (36)
      • see remark 999 (56)
      • see remark 999 (100)
  • Chain 'D':
    Compound: ribosomal protein L37a
    Species: Oryza sativa [TaxId:4530]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: 40S ribosomal protein S13
    Species: Oryza sativa [TaxId:4530]
    Database cross-references and differences (RAF-indexed):
    • GB XP_479793 (0-83)
  • Chain 'F':
    Compound: RNA (34-mer)
    Species: synthetic construct, synthetic [TaxId:32630]

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >1yshC (C:)
    kakksgeninnklqlvmksgkytlgyktvlktlrsskgkliilanncpplrkseieyyam
    lakisvhhfhgnnvdlgtacgkyyrvcclsildpgdsdiisttt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >1yshD (D:)
    ivgkygtrygaslrkqikkmevsqhskyfcefcgkfavkrkavgiwgckdcgkvkaggay
    tmntasavtvrst
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >1yshE (E:)
    svtgskilrilkahglapeipedlyflikkavairkhlernrkdkdskfrlilvesrihr
    laryykrtkklpptwkyesttast
    

  • Chain 'F':
    No sequence available.