PDB entry 1ysg

View 1ysg on RCSB PDB site
Description: Solution Structure of the Anti-apoptotic Protein Bcl-xL in Complex with "SAR by NMR" Ligands
Class: apoptosis
Keywords: complex, apoptosis
Deposited on 2005-02-08, released 2005-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apoptosis regulator bcl-x
    Species: Homo sapiens [TaxId:9606]
    Gene: BCL2L1, BCL2L, BCLX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07817 (4-47)
      • cloning artifact (0-3)
      • cloning artifact (173-179)
      • cloning artifact (140)
    • Uniprot Q07817 (48-172)
    Domains in SCOPe 2.07: d1ysga2, d1ysga3
  • Heterogens: 4FC, TN1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ysgA (A:)
    msmamsqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagde
    felryrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvd
    kemqvlvsriaawmatylndhlepwiqenggwdtfvelygnnaaaesrkgqerlehhhhh
    h