PDB entry 1ysc

View 1ysc on RCSB PDB site
Description: 2.8 angstroms structure of yeast serine carboxypeptidase
Class: hydrolase(carboxypeptidase)
Keywords: hydrolase(carboxypeptidase)
Deposited on 1994-03-08, released 1994-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine carboxypeptidase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ysca_
  • Heterogens: NDG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yscA (A:)
    kikdpkilgidpnvtqytgyldvededkhfffwtfesrndpakdpvilwlnggpgcsslt
    glffelgpssigpdlkpignpyswnsnatvifldqpvnvgfsysgssgvsntvaagkdvy
    nflelffdqfpeyvnkgqdfhiagesyaghyipvfaseilshkdrnfnltsvligngltd
    pltqynyyepmacgeggepsvlpseecsamedslerclgliescydsqsvwscvpatiyc
    nnaqlapyqrtgrnvydirkdceggnlcyptlqdiddylnqdyvkeavgaevdhyescnf
    dinrnflfagdwmkpyhtavtdllnqdlpilvyagdkdficnwlgnkawtdvlpwkydee
    fasqkvrnwtasitdevagevksykhftylrvfngghmvpfdvpenalsmvnewihggfs
    l