PDB entry 1ysb

View 1ysb on RCSB PDB site
Description: Yeast Cytosine Deaminase Triple Mutant
Class: hydrolase
Keywords: hydrolase
Deposited on 2005-02-08, released 2005-05-17
The last revision prior to the SCOP 1.73 freeze date was dated 2005-05-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.162
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytosine deaminase
    Species: Saccharomyces cerevisiae
    Gene: fcy1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12178
      • engineered (25)
      • engineered (110)
      • engineered (142)
    Domains in SCOP 1.73: d1ysba1
  • Chain 'B':
    Compound: Cytosine deaminase
    Species: Saccharomyces cerevisiae
    Gene: fcy1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12178 (3-160)
      • cloning artifact (0-2)
      • engineered (25)
      • engineered (110)
      • engineered (142)
    Domains in SCOP 1.73: d1ysbb1
  • Heterogens: ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ysbA (A:)
    gssmvtggmaskwdqkgmdiayeeallgykeggvpiggclinnkdgsvlgrghnmrfqkg
    satlhgeistlencgrlegkvykdttlyttlspcdmctgaiimygiprcvigenvnfksk
    gekylqtrghevvvvdderckklmkqfiderpqdwfedige
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ysbA (A:)
    tggmaskwdqkgmdiayeeallgykeggvpiggclinnkdgsvlgrghnmrfqkgsatlh
    geistlencgrlegkvykdttlyttlspcdmctgaiimygiprcvigenvnfkskgekyl
    qtrghevvvvdderckklmkqfiderpqdwfedige
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ysbB (B:)
    gssmvtggmaskwdqkgmdiayeeallgykeggvpiggclinnkdgsvlgrghnmrfqkg
    satlhgeistlencgrlegkvykdttlyttlspcdmctgaiimygiprcvigenvnfksk
    gekylqtrghevvvvdderckklmkqfiderpqdwfedige