PDB entry 1ysa

View 1ysa on RCSB PDB site
Description: the gcn4 basic region leucine zipper binds DNA as a dimer of uninterrupted alpha helices: crystal structure of the protein-DNA complex
Class: transcription/DNA
Keywords: protein-DNA complex, double helix, transcription/DNA complex
Deposited on 1993-08-09, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.23
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (5'-d(*tp*tp*cp*cp*tp*ap*tp*gp*ap*cp*tp*cp*ap*tp*cp*cp*a p*gp*tp*t)-3')
  • Chain 'B':
    Compound: DNA (5'-d(*ap*ap*ap*cp*tp*gp*gp*ap*tp*gp*ap*gp*tp*cp*ap*tp*a p*gp*gp*a)-3')
  • Chain 'C':
    Compound: protein (gcn4)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ysac_
  • Chain 'D':
    Compound: protein (gcn4)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ysad_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ysaC (C:)
    mkdpaalkrarnteaarrsrarklqrmkqledkveellsknyhlenevarlkklvger
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ysaC (C:)
    kdpaalkrarnteaarrsrarklqrmkqledkveellsknyhlenevarlkklvger
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ysaD (D:)
    mkdpaalkrarnteaarrsrarklqrmkqledkveellsknyhlenevarlkklvger
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ysaD (D:)
    mkdpaalkrarnteaarrsrarklqrmkqledkveellsknyhlenevarlkklvge