PDB entry 1ys9

View 1ys9 on RCSB PDB site
Description: Crystal structure of phosphatase SPy1043 from Streptococcus pyogenes
Class: structural genomics, unknown function
Keywords: Structural genomics, NYSGXRC target T2098, unknown function, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGRC
Deposited on 2005-02-07, released 2005-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-14, with a file datestamp of 2016-12-09.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein SPy1043
    Species: STREPTOCOCCUS PYOGENES [TaxId:160490]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ys9a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ys9A (A:)
    vpykgylidldgtiyqgknripagerfikrlqergipyllvtnnttrtpemvqsmlanqf
    hvetsietiytatmatvdymndmnrgktayvigetglksaiaaagyveelenpayvvvgl
    dsqvtyemlaiatlaiqkgalfigtnpdlnipterglmpgagalnalleaatrvkpvfig
    kpnaiimnkslevlgiqrseavmvgdnyltdimagiqndiatilvttgftrpeevptlpi
    qpdhvlssldewrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ys9A (A:)
    pykgylidldgtiyqgknripagerfikrlqergipyllvtnnttrtpemvqsmlanqfh
    vetsietiytatmatvdymndmnrgktayvigetglksaiaaagyveelenpayvvvgld
    sqvtyemlaiatlaiqkgalfigtnpdlnipterglmpgagalnalleaatrvkpvfigk
    pnaiimnkslevlgiqrseavmvgdnyltdimagiqndiatilvttgftrpeevptlpiq
    pdhvlssldewrl