PDB entry 1ys7

View 1ys7 on RCSB PDB site
Description: Crystal structure of the response regulator protein prrA complexed with Mg2+
Class: transcription regulator
Keywords: Response regulator, DNA binding domain, phosphorylation, Mycobacterium Tuberculosis Structural Proteomics Project, XMTB, Structural Genomics, TRANSCRIPTION REGULATOR
Deposited on 2005-02-07, released 2006-02-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulatory protein prrA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ys7a1, d1ys7a2
  • Chain 'B':
    Compound: Transcriptional regulatory protein prrA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ys7b1, d1ys7b2
  • Heterogens: MG, ACT, TRS, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ys7A (A:)
    mdtgvtsprvlvvdddsdvlaslerglrlsgfevatavdgaealrsatenrpdaivldin
    mpvldgvsvvtalramdndvpvcvlsarssvddrvagleagaddylvkpfvlaelvarvk
    allrrrgstatsssetitvgplevdipgrrarvngvdvdltkrefdllavlaehktavls
    raqllelvwgydfaadtnvvdvfigylrrkleagggprllhtvrgvgfvlrmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ys7A (A:)
    sprvlvvdddsdvlaslerglrlsgfevatavdgaealrsatenrpdaivldinmpvldg
    vsvvtalramdndvpvcvlsarssvddrvagleagaddylvkpfvlaelvarvkallrrr
    gstatsssetitvgplevdipgrrarvngvdvdltkrefdllavlaehktavlsraqlle
    lvwgydfadtnvvdvfigylrrkleagprllhtvrgvgfvlrmq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ys7B (B:)
    mdtgvtsprvlvvdddsdvlaslerglrlsgfevatavdgaealrsatenrpdaivldin
    mpvldgvsvvtalramdndvpvcvlsarssvddrvagleagaddylvkpfvlaelvarvk
    allrrrgstatsssetitvgplevdipgrrarvngvdvdltkrefdllavlaehktavls
    raqllelvwgydfaadtnvvdvfigylrrkleagggprllhtvrgvgfvlrmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ys7B (B:)
    sprvlvvdddsdvlaslerglrlsgfevatavdgaealrsatenrpdaivldinmpvldg
    vsvvtalramdndvpvcvlsarssvddrvagleagaddylvkpfvlaelvarvkallrrr
    gstatsssetitvgplevdipgrrarvngvdvdltkrefdllavlaehktavlsraqlle
    lvwgydfaadtnvvdvfigylrrkleaggprllhtvrgvgfvlrmq