PDB entry 1ys5

View 1ys5 on RCSB PDB site
Description: Solution structure of the antigenic domain of GNA1870 of Neisseria meningitidis
Class: signaling protein
Keywords: vaccine candidate, Neisseria meningitidis, beta-barrel structure, SIGNALING PROTEIN
Deposited on 2005-02-07, released 2006-02-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipoprotein
    Species: Neisseria meningitidis [TaxId:487]
    Gene: gna1870
    Database cross-references and differences (RAF-indexed):
    • GB AAT01290 (1-155)
      • initiating methionine (0)
    Domains in SCOPe 2.08: d1ys5a1, d1ys5a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ys5A (A:)
    mqshsaltafqteqiqdsehsgkmvakrqfrigdiagehtsfdklpeggratyrgtafgs
    ddaggkltytidfaakqgngkiehlkspelnvdlaaadikpdgkrhavisgsvlynqaek
    gsyslgifggkaqevagsaevktvngirhiglaakqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ys5A (A:)
    mqshsaltafqteqiqdsehsgkmvakrqfrigdiagehtsfdklpeggratyrgtafgs
    ddaggkltytidfaakqgngkiehlkspelnvdlaaadikpdgkrhavisgsvlynqaek
    gsyslgifggkaqevagsaevktvngirhiglaakq