PDB entry 1ys4

View 1ys4 on RCSB PDB site
Description: structure of aspartate-semialdehyde dehydrogenase from methanococcus jannaschii
Deposited on 2005-02-07, released 2005-11-01
The last revision was dated 2015-04-29, with a file datestamp of 2015-04-24.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate-semialdehyde dehydrogenase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: ASD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57658 (Start-353)
      • modified residue (6)
      • modified residue (32)
      • modified residue (68)
      • modified residue (118)
      • modified residue (169)
      • modified residue (182)
      • modified residue (196)
      • modified residue (213)
      • modified residue (270)
      • modified residue (309)
  • Chain 'B':
    Compound: aspartate-semialdehyde dehydrogenase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: ASD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57658 (Start-353)
      • modified residue (6)
      • modified residue (32)
      • modified residue (68)
      • modified residue (118)
      • modified residue (169)
      • modified residue (182)
      • modified residue (196)
      • modified residue (213)
      • modified residue (270)
      • modified residue (309)
  • Heterogens: NAP, MLA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1ys4A (A:)
    mskgekmkikvgvlgatgsvgqrfvqlladhpmfeltalaasersagkkykdacywfqdr
    dipenikdmvviptdpkheefedvdivfsalpsdlakkfepefakegklifsnasayrme
    edvplvipevnadhlelieiqrekrgwdgaiitnpncsticavitlkpimdkfgleavfi
    atmqavsgagyngvpsmaildnlipfikneeekmqteslkllgtlkdgkvelanfkisas
    cnrvavidghtesifvktkegaepeeikevmdkfdplkdlnlptyakpivireeidrpqp
    rldrnegngmsivvgrirkdpifdvkytalehntirgaagasvlnaeyfvkkyi
    

    Sequence, based on observed residues (ATOM records):
    >1ys4A (A:)
    mkikvgvlgatgsvgqrfvqlladhpmfeltalaasersagkkykdacywfqdrdipeni
    kdmvviptdpkheefedvdivfsalpsdlakkfepefakegklifsnasayrmeedvplv
    ipevnadhlelieiqrekrgwdgaiitnpncsticavitlkpimdkfgleavfiatmqav
    sgagyngvpsmaildnlipfikneeekmqteslkllgtlkdgkvelanfkisascnrvav
    idghtesifvktkegaepeeikevmdkfdplkdlnlptyakpivireeidrpqprldrne
    gngmsivvgrirkdpifdvkytalehntirgaagasvlnaeyfvkkyi
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1ys4B (B:)
    mskgekmkikvgvlgatgsvgqrfvqlladhpmfeltalaasersagkkykdacywfqdr
    dipenikdmvviptdpkheefedvdivfsalpsdlakkfepefakegklifsnasayrme
    edvplvipevnadhlelieiqrekrgwdgaiitnpncsticavitlkpimdkfgleavfi
    atmqavsgagyngvpsmaildnlipfikneeekmqteslkllgtlkdgkvelanfkisas
    cnrvavidghtesifvktkegaepeeikevmdkfdplkdlnlptyakpivireeidrpqp
    rldrnegngmsivvgrirkdpifdvkytalehntirgaagasvlnaeyfvkkyi
    

    Sequence, based on observed residues (ATOM records):
    >1ys4B (B:)
    mkikvgvlgatgsvgqrfvqlladhpmfeltalaasersagkkykdacywfqdrdipeni
    kdmvviptdpkheefedvdivfsalpsdlakkfepefakegklifsnasayrmeedvplv
    ipevnadhlelieiqrekrgwdgaiitnpncsticavitlkpimdkfgleavfiatmqav
    sgagyngvpsmaildnlipfikneeekmqteslkllgtlkdgkvelanfkisascnrvav
    idghtesifvktkegaepeeikevmdkfdplkdlnlptyakpivireeidrpqprldrne
    gngmsivvgrirkdpifdvkytalehntirgaagasvlnaeyfvkkyi