PDB entry 1ys1

View 1ys1 on RCSB PDB site
Description: Burkholderia cepacia lipase complexed with hexylphosphonic acid (R)-2-methyl-3-phenylpropyl ester
Class: hydrolase
Keywords: cis peptide Leu 234, Ca2+ ion, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, HYDROLASE
Deposited on 2005-02-06, released 2005-05-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.15
AEROSPACI score: 0.93 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Lipase
    Species: Burkholderia cepacia [TaxId:292]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22088 (0-319)
      • see remark 999 (1-2)
      • see remark 999 (17)
      • see remark 999 (39)
      • see remark 999 (91)
      • see remark 999 (124)
      • see remark 999 (136)
      • see remark 999 (153)
      • see remark 999 (164)
      • see remark 999 (170)
      • see remark 999 (217)
      • see remark 999 (220)
      • see remark 999 (231)
      • see remark 999 (239)
      • see remark 999 (242)
      • see remark 999 (255)
      • see remark 999 (265)
      • see remark 999 (275)
      • see remark 999 (299)
    Domains in SCOPe 2.06: d1ys1x_
  • Heterogens: CA, 2HR, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ys1X (X:)
adnyaatrypiilvhgltgtdkyagvleywygiqedlqqrgatvyvanlsgfqsddgpng
rgeqllayvktvlaatgatkvnlvghsqggltsryvaavapdlvasvttigtphrgsefa
dfvqgvlaydptglsstviaafvnvfgiltsssnntnqdalaalktlttaqaatynqnyp
saglgapgscqtgaptetvggnthllyswagtaiqptisvggvtgatdtstiplvdpana
ldpstlalfgtgtvmvnrgsgqndgvvskcsalygqvlstsykwnhldeinqllgvrgan
aedpvavirthanrlklagv