PDB entry 1ys0

View 1ys0 on RCSB PDB site
Description: Crystal Structure of the CDC25B phosphatase catalytic domain with the active site cysteine in the disulfide form
Class: hydrolase, cell cycle
Keywords: disulfide bond, HYDROLASE, CELL CYCLE
Deposited on 2005-02-05, released 2005-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.209
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: M-phase inducer phosphatase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC25B, CDC25HU2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30305 (1-174)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d1ys0a_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ys0A (A:)
    meligdyskafllqtvdgkhqdlkyispetmvalltgkfsnivdkfvivdcrypyeyegg
    hiktavnlplerdaesfllkspiapcsldkrvilifhcefssergprmcrfirerdravn
    dypslyypemyilkggykeffpqhpnfcepqdyrpmnheafkdelktfrlktrsw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ys0A (A:)
    meligdyskafllqtvdgkhqdlkyispetmvalltgkfsnivdkfvivdcrypyeyegg
    hiktavnlplerdaesfllkspiapkrvilifhcefssergprmcrfirerdravndyps
    lyypemyilkggykeffpqhpnfcepqdyrpmnheafkdelktfrlktrsw