PDB entry 1yrz

View 1yrz on RCSB PDB site
Description: Crystal structure of xylan beta-1,4-xylosidase from Bacillus Halodurans C-125
Class: hydrolase
Keywords: Structural genomics, NYSGXRC target T1997, xylosidase, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGRC, HYDROLASE
Deposited on 2005-02-05, released 2005-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.207
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylan beta-1,4-xylosidase
    Species: BACILLUS HALODURANS [TaxId:272558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yrza1, d1yrza2
  • Chain 'B':
    Compound: xylan beta-1,4-xylosidase
    Species: BACILLUS HALODURANS [TaxId:272558]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yrzb1, d1yrzb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yrzA (A:)
    mvnriqnpilpgfhpdpsivrvgddyyiatstfewfpgvrihhsrdlkhwrfvsspltrt
    sqldmkgnmnsggiwapclsyhdgtfyliytdvkqwhgafkdahnylvtaqniegpwsdp
    iylnssgfdpslfhdddgrkwlvnmiwdyrkgnhpfagiilqeyseaeqklvgpvkniyk
    gtdiqltegphlykkdgyyyllvaeggteyehaatlarsqsidgpyetdpsyplvtstgq
    pelalqkaghgslvetqngewylahlcgrplkgkyctlgretaiqkvnwtedgwlriedg
    gnhplrevtapdlpehpfekepelddfdapqlhhqwntlripadpswcsleerpghlrlr
    gmesltsvhsqslvarrqqsfhcevetkleyqpesfqhmaglviyydtedhvylhvtwhe
    ekgkclqiiqtkggnydellaspiplaeekavylkgrihretmhlyfkqegeaewqpvgp
    tidvthmsddsakqvrftgtfvgmatqdlsgtkkpadfdyfrykeldq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrzA (A:)
    riqnpilpgfhpdpsivrvgddyyiatstfewfpgvrihhsrdlkhwrfvsspltrtsql
    dmkgnmnsggiwapclsyhdgtfyliytdvkqwhgafkdahnylvtaqniegpwsdpiyl
    nssgfdpslfhdddgrkwlvnmiwdyrkgnhpfagiilqeyseaeqklvgpvkniykgtd
    iqltegphlykkdgyyyllvaeggteyehaatlarsqsidgpyetdpsyplvtstgqpel
    alqkaghgslvetqngewylahlcgrplkgkyctlgretaiqkvnwtedgwlriedggnh
    plrevtapdlpehpfekepelddfdapqlhhqwntlripadpswcsleerpghlrlrgme
    sltsvhsqslvarrqqsfhcevetkleyqpesfqhmaglviyydtedhvylhvtwheekg
    kclqiiqtkggnydellaspiplaeekavylkgrihretmhlyfkqegeaewqpvgptid
    vthmsddsakqvrftgtfvgmatqdlsgtkkpadfdyfryke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yrzB (B:)
    mvnriqnpilpgfhpdpsivrvgddyyiatstfewfpgvrihhsrdlkhwrfvsspltrt
    sqldmkgnmnsggiwapclsyhdgtfyliytdvkqwhgafkdahnylvtaqniegpwsdp
    iylnssgfdpslfhdddgrkwlvnmiwdyrkgnhpfagiilqeyseaeqklvgpvkniyk
    gtdiqltegphlykkdgyyyllvaeggteyehaatlarsqsidgpyetdpsyplvtstgq
    pelalqkaghgslvetqngewylahlcgrplkgkyctlgretaiqkvnwtedgwlriedg
    gnhplrevtapdlpehpfekepelddfdapqlhhqwntlripadpswcsleerpghlrlr
    gmesltsvhsqslvarrqqsfhcevetkleyqpesfqhmaglviyydtedhvylhvtwhe
    ekgkclqiiqtkggnydellaspiplaeekavylkgrihretmhlyfkqegeaewqpvgp
    tidvthmsddsakqvrftgtfvgmatqdlsgtkkpadfdyfrykeldq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrzB (B:)
    riqnpilpgfhpdpsivrvgddyyiatstfewfpgvrihhsrdlkhwrfvsspltrtsql
    dmkgnmnsggiwapclsyhdgtfyliytdvkqwhgafkdahnylvtaqniegpwsdpiyl
    nssgfdpslfhdddgrkwlvnmiwdyrkgnhpfagiilqeyseaeqklvgpvkniykgtd
    iqltegphlykkdgyyyllvaeggteyehaatlarsqsidgpyetdpsyplvtstgqpel
    alqkaghgslvetqngewylahlcgrplkgkyctlgretaiqkvnwtedgwlriedggnh
    plrevtapdlpehpfekepelddfdapqlhhqwntlripadpswcsleerpghlrlrgme
    sltsvhsqslvarrqqsfhcevetkleyqpesfqhmaglviyydtedhvylhvtwheekg
    kclqiiqtkggnydellaspiplaeekavylkgrihretmhlyfkqegeaewqpvgptid
    vthmsddsakqvrftgtfvgmatqdlsgtkkpadfdyfryke