PDB entry 1yry

View 1yry on RCSB PDB site
Description: Crystal structure of human PNP complexed with MESG
Class: transferase
Keywords: Purine nucleoside phosphorylase, drug design, synchrotron, MESG, TRANSFERASE
Deposited on 2005-02-05, released 2006-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.207
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: purine nucleoside phosphorylase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yrye_
  • Heterogens: SO4, MSG, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1yryE (E:)
    mengytyedykntaewllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfprst
    vpghagrlvfgflngracvmmqgrfhmyegyplwkvtfpvrvfhllgvdtlvvtnaaggl
    npkfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstwkq
    mgeqrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgfsl
    itnkvimdyeslekanheevlaagkqaaqkleqfvsilmasiplpdkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yryE (E:)
    engytyedykntaewllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfprstv
    pghagrlvfgflngracvmmqgrfhmyegyplwkvtfpvrvfhllgvdtlvvtnaaggln
    pkfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstwkqm
    geqrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgfsli
    tnkvimdyeslekanheevlaagkqaaqkleqfvsilmasiplpdkas