PDB entry 1yrx

View 1yrx on RCSB PDB site
Description: Structure of a novel photoreceptor: the BLUF domain of AppA from Rhodobacter sphaeroides
Class: transcription
Keywords: ferredoxin-like fold, flavin binding, photoreceptor
Deposited on 2005-02-05, released 2005-06-28
The last revision prior to the SCOP 1.75 freeze date was dated 2005-06-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.243
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein Rsph03001874
    Species: Rhodobacter sphaeroides
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53119 (4-End)
      • cloning artifact (0-3)
    Domains in SCOP 1.75: d1yrxa1
  • Chain 'B':
    Compound: hypothetical protein Rsph03001874
    Species: Rhodobacter sphaeroides
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53119 (4-End)
      • cloning artifact (1-3)
    Domains in SCOP 1.75: d1yrxb1
  • Chain 'C':
    Compound: hypothetical protein Rsph03001874
    Species: Rhodobacter sphaeroides
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53119 (4-End)
      • cloning artifact (2-3)
    Domains in SCOP 1.75: d1yrxc1
  • Heterogens: FMN, D9G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yrxA (A:)
    aghmvsccyrslaapdltlrdlldivetsqahnaraqltgalfysqgvffqwlegrpaav
    aevmthiqrdrrhsnveilaeepiakrrfagwhmqlscseadmrslglaesrqivtvgrs
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrxA (A:)
    aghmvsccyrslaapdltlrdlldivetsqahnaraqltgalfysqgvffqwlegrpaav
    aevmthiqrdrrhsnveilaeepiakrrfagwhmqlscseadmrslglaesrqivtvg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yrxB (B:)
    aghmvsccyrslaapdltlrdlldivetsqahnaraqltgalfysqgvffqwlegrpaav
    aevmthiqrdrrhsnveilaeepiakrrfagwhmqlscseadmrslglaesrqivtvgrs
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrxB (B:)
    ghmvsccyrslaapdltlrdlldivetsqahnaraqltgalfysqgvffqwlegrpaava
    evmthiqrdrrhsnveilaeepiakrrfagwhmqlscseadmrslglaesrqivtv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yrxC (C:)
    aghmvsccyrslaapdltlrdlldivetsqahnaraqltgalfysqgvffqwlegrpaav
    aevmthiqrdrrhsnveilaeepiakrrfagwhmqlscseadmrslglaesrqivtvgrs
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yrxC (C:)
    hmvsccyrslaapdltlrdlldivetsqahnaraqltgalfysqgvffqwlegrpaavae
    vmthiqrdrrhsnveilaeepiakrrfagwhmqlscseadmrslglaesrqivtv